General Information

  • ID:  hor005527
  • Uniprot ID:  P19872
  • Protein name:  Adipokinetic hormone 3
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFTPWW
  • Length:  8(23-30)
  • Propeptide:  MQVRAVLVLAVVALVAVATSRAQLNFTPWWGKRALGAPAAGDCVSASPQALLSILNAAQAEVQKLIDCSRFTSEANS
  • Signal peptide:  MQVRAVLVLAVVALVAVATSRA
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19872-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005527_AF2.pdbhor005527_ESM.pdb

Physical Information

Mass: 121627 Formula: C55H70N12O12
Absent amino acids: ACDEGHIKMRSVY Common amino acids: W
pI: 6.11 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -56.25 Boman Index: -219
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: -1363.75 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1571.43

Literature

  • PubMed ID:  7559443
  • Title:  Molecular cloning of three distinct cDNAs, each encoding a different adipokinetic hormone precursor, of the migratory locust, Locusta migratoria. Differential expression of the distinct adipokinetic hormone precursor genes during flight activity.
  • PubMed ID:  1997320
  • Title:   Isolat